RGS20 Antibody

  • Contact Vendor

Target RGS20
Species Cross Reactivity Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications WB
Target Species Homo sapiens
Target/Molecule Synonym G(z)GAP, Gz-GAP, Gz-selective GTPase-activating protein, regulator of G-protein signalling 20, Regulator of Gz-selective protein signaling 1, regulator of G-protein signaling 20, Regulator of G-protein signaling Z1, RGSZ1g(z)GAP, ZGAP1gz-GAP
Unit 0.1 mg
Format IgG purified
Concentration LYOPH
NCBI Gene Aliases RGSZ1, ZGAP1
Company Novus Biologicals
Type Antibody
Immunogen Synthetic peptides corresponding to RGS20 (regulator of G-protein signalling 20) The peptide sequence was selected from the N terminal of RGS20. Peptide sequence KHFSRPSIWTQFLPLFRAQRYNTDIHQITENEGDLRAVPDIKSFPPAQLP