RGS17 Antibody

  • Contact Vendor

Target RGS17
Species Cross Reactivity Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications IHC
Target Species Homo sapiens
Target/Molecule Synonym hRGS17, regulator of G-protein signalling 17, regulator of G-protein signaling 17, RGS-17, RGSZ2
Unit 0.1 ml
Format Immunogen affinity purified
NCBI Gene Aliases RGS-17, RGSZ2, hRGS17
Company Novus Biologicals
Type Antibody
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:NEGTPAVSQAPGNQRPNNTCCFCWCCCCSCSCLTVRNEERGENAGRPTHTTKMESIQVLEECQNPTAEEVLSWSQNFDKMMKAPAGRNLFREFLRTEY