SHARPIN Antibody

  • Contact Vendor

Target Sharpin
Species Cross Reactivity Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications WB
Target Species Homo sapiens
Target/Molecule Synonym DKFZp434N1923, hSIPL1, SHANK-associated RH domain interactor, Shank-associated RH domain-interacting protein, Shank-interacting protein-like 1, sharpin, SIPL1DKFZP434N1923
Unit 0.05 mg
Format Peptide affinity purified
Concentration LYOPH
NCBI Gene Aliases DKFZp434N1923, SIPL1
Cite This Product Novus Biologicals cat# NBP1-79754 RRID:AB_11015374
Company Novus Biologicals
Type Antibody
Immunogen Synthetic peptide directed towards the C terminal of human SHARPINThe immunogen for this antibody is SHARPIN. Peptide sequence SAPREAPATGPSPQHPQKMDGELGRLFPPSLGLPPGPQPAASSLPSPLQP