SHARPIN Antibody

  • Contact Vendor

Target Sharpin
Species Cross Reactivity Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications WB, IHC
Target Species Homo sapiens
Target/Molecule Synonym DKFZp434N1923, hSIPL1, SHANK-associated RH domain interactor, Shank-associated RH domain-interacting protein, Shank-interacting protein-like 1, sharpin, SIPL1DKFZP434N1923
Unit 0.1 ml
Format Immunogen affinity purified
NCBI Gene Aliases DKFZp434N1923, SIPL1
Company Novus Biologicals
Type Antibody
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:KSNSPPALGPEACPVSLPSPPEASTLKGPPPEADLPRSPGNLTEREELAGSLARAIAGGDEKGAAQVAAVLAQHRVALSVQLQEACFPPG