RNA Helicase A Antibody

  • Contact Vendor

Target DHX9
Species Cross Reactivity Canis lupus familiaris, Rattus norvegicus, Mus musculus, Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications WB, IHC
Target Species Homo sapiens
Target/Molecule Synonym DDX9ATP-dependent RNA helicase A, DEAH (Asp-Glu-Ala-His) box polypeptide 9, DEAH box protein 9, DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 9, DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 9 (RNA helicase A, nuclear DNAhelicase II; leukophysin), EC 3.6.4.13, EC 3.6.1.15, EC 3.6.1, FLJ17406, leukophysin, LKP, NDH II, NDH2, NDHII, Nuclear DNA helicase II, RHA
Unit 0.05 mg
Format Peptide affinity purified
Concentration LYOPH
NCBI Gene Aliases DDX9, FLJ17406, LKP, NDH2, NDHII, RHA
Company Novus Biologicals
Type Antibody
Immunogen Synthetic peptides corresponding to DHX9(DEAH (Asp-Glu-Ala-His) box polypeptide 9) The peptide sequence was selected from the N terminal of DHX9. Peptide sequence GLHGNWTLENAKARLNQYFQKEKIQGEYKYTQVGPDHNRSFIAEMTIYIK