RTDR1 Antibody

  • Contact Vendor

Target RTDR1
Species Cross Reactivity Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications WB
Target Species Homo sapiens
Target/Molecule Synonym MGC16968, rhabdoid tumor deletion region gene 1, rhabdoid tumor deletion region protein 1
Unit 0.05 mg
Format Peptide affinity purified
Concentration LYOPH
NCBI Gene Aliases MGC16968
Company Novus Biologicals
Type Antibody
Immunogen Synthetic peptides corresponding to RTDR1(rhabdoid tumor deletion region gene 1) The peptide sequence was selected from the middle region of RTDR1. Peptide sequence IARLNATKALTMLAEAPEGRKALQTHVPTFRAMEVETYEKPQVAEALQRA