RTDR1 Antibody

  • Contact Vendor

Target RTDR1
Species Cross Reactivity Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications WB, IHC
Target Species Homo sapiens
Target/Molecule Synonym MGC16968, rhabdoid tumor deletion region gene 1, rhabdoid tumor deletion region protein 1
Unit 0.1 ml
Format Immunogen affinity purified
NCBI Gene Aliases MGC16968
Company Novus Biologicals
Type Antibody
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:SLELPININATQITTAYGHRALPKLKEELQSEDLQTRQKALMALCDLMHDPECIYKAMNIGCMENLKALLKD