RHAG Antibody

  • Contact Vendor

Target RHAG
Species Cross Reactivity Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications WB
Target Species Homo sapiens
Target/Molecule Synonym ammonium transporter Rh type A, CD241, CD241 antigen, Erythrocyte membrane glycoprotein Rh50, Erythrocyte plasma membrane 50 kDa glycoprotein, Rhesus blood group-associated glycoproteinRH2, Rh family type A glycoprotein, Rh type A glycoprotein, RH50, Rh50A, RH50ARh50, Rh50GP, Rh-associated glycoprotein, Rhesus associated polypeptide, 50-KD, Rhesus blood group family type A glycoprotein, Rhesus blood group-associated ammonia channel, SLC42A1
Unit 0.1 mg
Format IgG purified
Concentration LYOPH
NCBI Gene Aliases CD241, RH2, RH50A, Rh50, Rh50GP, SLC42A1
Company Novus Biologicals
Type Antibody
Immunogen Synthetic peptides corresponding to RHAG(Rh-associated glycoprotein) The peptide sequence was selected from the middle region of RHAG. Peptide sequence FGAVLGKTSPTQMLIMTILEIVFFAHNEYLVSEIFKASDIGASMTIHAFG