RHBDF1 Antibody

  • Contact Vendor

Target RHBDF1
Species Cross Reactivity Rattus norvegicus, Mus musculus, Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications WB
Target Species Homo sapiens
Target/Molecule Synonym C16orf8, chromosome 16 open reading frame 8, Dist1, EGFR-RS, epidermal growth factor receptor, related sequence, FLJ2235, FLJ22357, gene-89, gene-90, hDist1, p100hRho, Rhomboid 5 homolog 1, rhomboid 5 homolog 1 (Drosophila), rhomboid family 1, rhomboid family 1 (Drosophila), rhomboid family member 1
Unit 0.05 mg
Format Peptide affinity purified
Concentration LYOPH
NCBI Gene Aliases C16orf8, Dist1, EGFR-RS, FLJ2235, FLJ22357, gene-89, gene-90, hDist1
Company Novus Biologicals
Type Antibody
Immunogen Synthetic peptides corresponding to RHBDF1(rhomboid 5 homolog 1 (Drosophila)) The peptide sequence was selected from the N terminal of RHBDF1. Peptide sequence KDWEKAPEQADLTGGALDRSELERSHLMLPLERGWRKQKEGAAAPQPKVR