RHBDL2 Antibody

  • Contact Vendor

Target RHBDL2
Species Cross Reactivity Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications IHC
Target Species Homo sapiens
Target/Molecule Synonym EC 3.4.21.105, FLJ20435, MGC16997, rhomboid (veinlet, Drosophila)-like 2, rhomboid protease 2, rhomboid, veinlet-like 2 (Drosophila), Rhomboid-like protein 2, rhomboid-related protein 2, RRP2
Unit 0.1 ml
Format Immunogen affinity purified
NCBI Gene Aliases MGC16997, RRP2
Company Novus Biologicals
Type Antibody
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:YAVWKPQKQWITLDTGILESPFIYSPEKREEAWRFISY