RHBG Antibody

  • Contact Vendor

Target RHBG
Species Cross Reactivity Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications WB
Target Species Homo sapiens
Target/Molecule Synonym ammonium transporter Rh type B, Rh family type B glycoprotein, Rh family, B glycoprotein (gene/pseudogene), Rh type B glycoprotein, Rhesus blood group family type B glycoprotein, Rhesus blood group, B glycoprotein, SLC42A2
Unit 0.05 mg
Format Peptide affinity purified
Concentration LYOPH
NCBI Gene Aliases SLC42A2
Company Novus Biologicals
Type Antibody
Immunogen Synthetic peptides corresponding to RHBG (Rh family, B glycoprotein (gene/pseudogene)) The peptide sequence was selected from the N terminal of RHBG)(50ug). Peptide sequence RYNHKTDAALWHRSNHSNADNEFYFRYPSFQDVHAMVFVGFGFLMVFLQR