RHCE Antibody

  • Contact Vendor

Target RHCE
Species Cross Reactivity Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications WB
Target Species Homo sapiens
Target/Molecule Synonym blood group Rh(CE) polypeptide, blood group RhCcEe antigen, CD240CE, CD240CE antigen, MGC103977, Rhesus C/E antigens, Rhesus system C and E polypeptides, RhIVb(J), RhIXB, RHIXB, RHPI, RhPI, RhVI, RhVIII, RH, Rh blood group antigen Evans, Rh blood group C antigen, Rh blood group, CcEe antigens, Rh polypeptide 1, Rh polypeptide I, Rh30A, RH30A, Rh4, RHC, RHCE blood group variant Crawford antigen Rh43, RHE, Rhesus blood group CE protein, Rhesus blood group E antigen, Rhesus blood group Rhce antigen, Rhesus blood group, CcEe antigens, silenced Rh blood group CcEe antigen
Unit 0.05 mg
Format Peptide affinity purified
Concentration LYOPH
NCBI Gene Aliases CD240CE, MGC103977, RH, RH30A, RHC, RHE, RHIXB, RHPI, Rh4, RhIVb(J), RhVI, RhVIII
Company Novus Biologicals
Type Antibody
Immunogen Synthetic peptides corresponding to RHCE(Rh blood group, CcEe antigens) The peptide sequence was selected from the N terminal of RHCE. Peptide sequence SSKYPRSVRRCLPLCALTLEAALILLFYFFTHYDASLEDQKGLVASYQVG