Rheb Antibody

  • Contact Vendor

Target Rheb
Species Cross Reactivity Rattus norvegicus, Mus musculus, Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications WB
Target Species Homo sapiens
Target/Molecule Synonym GTP-binding protein Rheb, MGC111559, Ras homolog enriched in brainRHEB2Ras homolog enriched in brain 2
Unit 0.05 mg
Format Peptide affinity purified
Concentration LYOPH
NCBI Gene Aliases MGC111559, RHEB2
Company Novus Biologicals
Type Antibody
Immunogen Synthetic peptides corresponding to RHEB(Ras homolog enriched in brain) The peptide sequence was selected from the middle region of RHEB. Peptide sequence VGKVQIPIMLVGNKKDLHMERVISYEEGKALAESWNAAFLESSAKENQTA