RHEBL1 Antibody

  • Contact Vendor

Target RHEBL1
Species Cross Reactivity Mus musculus, Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications WB
Target Species Homo sapiens
Target/Molecule Synonym FLJ25797, GTPase RhebL1, MGC34869, Ras homolog enriched in brain like 1, Ras homolog enriched in brain like 1 c, Ras homolog enriched in brain like-1 c, Ras homolog enriched in brain-like protein 1, Rheb2, rheb2, RHEBL1c, RhebL1c, Rheb-like protein 1
Unit 0.05 mg
Format Peptide affinity purified
Concentration LYOPH
NCBI Gene Aliases FLJ25797, MGC34869, RHEBL1c
Company Novus Biologicals
Type Antibody
Immunogen Synthetic peptides corresponding to the N terminal of Rhebl1. Immunizing peptide sequence VEGEFLEGYDPTVENTYSKTVTLGKDEFHLHLVDTAGQDEYSILPYSLII