SYDE2 Antibody

  • Contact Vendor

Target SYDE2
Species Cross Reactivity Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications IHC
Target Species Homo sapiens
Target/Molecule Synonym FLJ13815, rho GTPase-activating protein SYDE2, RP11-33E12.1, synapse defective 1, Rho GTPase, homolog 2 (C. elegans), synapse defective protein 1 homolog 2
Unit 0.1 ml
Format Immunogen affinity purified
NCBI Gene Aliases FLJ13815, RP11-33E12.1
Company Novus Biologicals
Type Antibody
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:RSHLSISPVSLPKHQLSQSFLKSSKEYCTYVVCNATNSSLSKNCALDFNEENDADDEGEIWYNPIPEDDDLGISSALSFGEADSAVLKLPAVNLSMLS