SYDE1 Antibody

  • Contact Vendor

Target Syde1
Species Cross Reactivity Rattus norvegicus, Mus musculus, Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications WB
Target Species Homo sapiens
Target/Molecule Synonym EC 2.4.1.25, EC 2.6.1.9, FLJ13511, Protein syd-1 homolog 1, rho GTPase-activating protein SYDE1, synapse defective 1, Rho GTPase, homolog 1 (C. elegans), Synapse defective protein 1 homolog 1,7h3
Unit 0.05 mg
Format Peptide affinity purified
Concentration LYOPH
NCBI Gene Aliases 7h3, FLJ13511
Company Novus Biologicals
Type Antibody
Immunogen Synthetic peptides corresponding to SYDE1(synapse defective 1, Rho GTPase, homolog 1 (C. elegans)) The peptide sequence was selected from the C terminal of SYDE1. Peptide sequence PYLRPKRQPPLHLPLADPEVVTRPRGRGGPESPPSNRYAGDWSVCGRDFL