SYDE1 Antibody

  • Contact Vendor

Target Syde1
Species Cross Reactivity Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications IHC
Target Species Homo sapiens
Target/Molecule Synonym EC 2.4.1.25, EC 2.6.1.9, FLJ13511, Protein syd-1 homolog 1, rho GTPase-activating protein SYDE1, synapse defective 1, Rho GTPase, homolog 1 (C. elegans), Synapse defective protein 1 homolog 1,7h3
Unit 0.1 ml
Format Immunogen affinity purified
NCBI Gene Aliases 7h3, FLJ13511
Company Novus Biologicals
Type Antibody
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:GDWSVCGRDFLPCGRDFLSGPDYDHVTGSDSEDEDEEVGEPRVTGDFEDDFDAPFNPHLNLKDFDALILDLERELSKQINV