SRGAP1 Antibody

  • Contact Vendor

Target srGAP1
Species Cross Reactivity Mus musculus, Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications WB
Target Species Homo sapiens
Target/Molecule Synonym ARHGAP13srGAP1, FLJ22166, KIAA1304SLIT-ROBO Rho GTPase-activating protein 1, Rho GTPase-activating protein 13, SLIT-ROBO Rho GTPase activating protein 1
Unit 0.05 mg
Format Peptide affinity purified
Concentration LYOPH
NCBI Gene Aliases ARHGAP13, FLJ22166, KIAA1304
Company Novus Biologicals
Type Antibody
Immunogen Synthetic peptide directed towards the middle region of human Srgap1The immunogen for this antibody is Srgap1. Peptide sequence DAKELDGPVYEKCMAGGDYCDSPYSEHGTLEEVDQDAGTEPHTSEDECRG