ROCK2 Antibody

  • Contact Vendor

Target ROCK2
Species Cross Reactivity Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications WB, IHC
Target Species Homo sapiens
Target/Molecule Synonym coiled-coil-containing protein kinase 2, EC 2.7.11.1, EC 2.7.11, KIAA0619, p164 ROCK-2, rho-associated protein kinase 2, Rho-associated, coiled-coil containing protein kinase 2, Rho kinase 2
Unit 0.1 ml
Format Immunogen affinity purified
NCBI Gene Aliases KIAA0619
Company Novus Biologicals
Type Antibody
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:FVGNQLPFIGFTYYRENLLLSDSPSCRETDSIQSRKNEESQEIQKKLYTLEEHLSNEMQAKEELEQKCKSVNTRLEKTAKELEEEITLRKSVESALRQLEREKALLQHKNAEYQRKADHEADK