RhoB Antibody

  • Contact Vendor

Target RHOB
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications WB
Target Species Homo sapiens
Target/Molecule Synonym ARH6MSTP081, ARHBAplysia RAS-related homolog 6, h6, MST081, oncogene RHO H6, ras homolog gene family, member B, Rho cDNA clone 6, rho-related GTP-binding protein RhoB, RHOH6RhoB
Unit 50 ug
Format Peptide affinity purified
Concentration LYOPH mg/ml
NCBI Gene Aliases ARH6,ARHB,MST081,MSTP081,RHOH
Company Novus Biologicals
Immunogen Synthetic peptides corresponding to RHOB (ras homolog gene family, member B) The peptide sequence was selected from the middle region of RHOB)(50g). Peptide sequence CPNVPIILVANKKDLRSDEHVRTELARMKQEPVRTDDGRAMAVRIQAYDY.
Gene Name ras homolog gene family, member B