RHOBTB1 Antibody

  • Contact Vendor

Target Rhobtb1
Species Cross Reactivity Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications WB, IHC
Target Species Homo sapiens
Target/Molecule Synonym KIAA0740MGC33059, MGC33841, Rho-related BTB domain containing 1, rho-related BTB domain-containing protein 1
Unit 0.1 ml
Format Immunogen affinity purified
NCBI Gene Aliases KIAA0740, MGC33059, MGC33841
Company Novus Biologicals
Type Antibody
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:TQTLTGWSKGFIGMHREMQVNPISKRMGPMTVVRMDASVQPGPFRTLLQFLYTGQLDEKEKDLVGLAQIAEVLEM