RHOBTB3 Antibody

  • Contact Vendor

Target RHOBTB3
Species Cross Reactivity Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications WB, IHC
Target Species Homo sapiens
Target/Molecule Synonym EC 3.6.1.-, KIAA0878rho-related BTB domain-containing protein 3, Rho-related BTB domain containing 3
Unit 0.1 ml
Format Immunogen affinity purified
NCBI Gene Aliases KIAA0878
Company Novus Biologicals
Type Antibody
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:IIAAVGTRQNEELPCTCPLCTSDRGSCVSTTEGIQLAKELGATYLELHSLDDFYIGKYFGGVLEYFMIQALNQKTSEKMKKRKMSNSFHGIRPPQLEQPE