RhoD Antibody

  • Contact Vendor

Target Rhod
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications WB
Target Species Homo sapiens
Target/Molecule Synonym ARHDRHOM, ras homolog D, ras homolog gene family, member A, ras homolog gene family, member D, Rho, rho-related GTP-binding protein RhoD, Rho-related protein HP1, RhoD, RHOHP1, RhoHP1
Unit 50 ug
Format Peptide affinity purified
Concentration LYOPH mg/ml
NCBI Gene Aliases ARHD,RHOHP1,RHOM,Rh
Company Novus Biologicals
Immunogen Synthetic peptides corresponding to RHOD(ras homolog gene family, member D) The peptide sequence was selected from the N terminal of RHOD. Peptide sequence TAAQAAGEEAPPGVRSVKVVLVGDGGCGKTSLLMVFADGAFPESYTPTVF.
Gene Name ras homolog gene family, member D