RhoD Antibody

  • Contact Vendor

Target Rhod
Species Cross Reactivity Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications WB, IHC
Target Species Homo sapiens
Target/Molecule Synonym ARHDRHOM, ras homolog gene family, member A, ras homolog gene family, member D, ras homolog D, Rho, rho-related GTP-binding protein RhoD, Rho-related protein HP1, RhoD, RhoHP1, RHOHP1
Unit 0.05 mg
Format Peptide affinity purified
Concentration LYOPH
NCBI Gene Aliases ARHD, RHOHP1, RHOM, Rho
Company Novus Biologicals
Type Antibody
Immunogen Synthetic peptides corresponding to RHOD(ras homolog gene family, member D) The peptide sequence was selected from the C terminal of RHOD. Peptide sequence NGLEPVTYHRGQEMARSVGAVAYLECSARLHDNVHAVFQEAAEVALSSRG