TST Antibody

  • Contact Vendor

Target TST
Species Cross Reactivity Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications ICC, WB, IHC, IF
Target Species Homo sapiens
Target/Molecule Synonym EC 2.8.1, EC 2.8.1.1, MGC19578, RDSRhodanese, thiosulfate sulfurtransferase, thiosulfate sulfurtransferase (rhodanese)
Unit 0.1 ml
Format Immunogen affinity purified
NCBI Gene Aliases MGC19578, RDS
Company Novus Biologicals
Type Antibody
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:RSLLKTYEQVLENLESKRFQLVDSRSQGRFLGTEPEPDAVGLDSGHIRGAVNMPFMDFLTEDGFEKGPEELRALFQTKKVDLSQPLIATCRKGVTACHVALAAYLCGKPDVAVYDGSWSEWFRRAPPESRVSQGKS