TST Antibody

  • Contact Vendor

Target TST
Species Cross Reactivity Canis lupus familiaris, Rattus norvegicus, Mus musculus, Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications WB, IHC
Target Species Homo sapiens
Target/Molecule Synonym EC 2.8.1, EC 2.8.1.1, MGC19578, RDSRhodanese, thiosulfate sulfurtransferase, thiosulfate sulfurtransferase (rhodanese)
Unit 0.05 mg
Format Peptide affinity purified
Concentration LYOPH
NCBI Gene Aliases MGC19578, RDS
Company Novus Biologicals
Type Antibody
Immunogen Synthetic peptides corresponding to TST(thiosulfate sulfurtransferase (rhodanese)) The peptide sequence was selected from the middle region of TST. Peptide sequence GEHLGSFYAPRVWWMFRVFGHRTVSVLNGGFRNWLKEGHPVTSEPSRPEP