TSTD1 Antibody

  • Contact Vendor

Target TSTD1
Species Cross Reactivity Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications WB, IHC
Target Species Homo sapiens
Target/Molecule Synonym KAT, putative thiosulfate sulfurtransferase KAT, thiosulfate sulfurtransferase (rhodanese)-like domain containing 1, thiosulfate sulfurtransferase KAT, putative
Unit 0.1 ml
Format Immunogen affinity purified
Concentration 0.05 mg/ml
NCBI Gene Aliases KAT
Company Novus Biologicals
Type Antibody
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:MAGAPTVSLPELRSLLASGRARLFDVRSREEAAAGTIPGALNIPVSELESALQMEPAAFQALYSAEKPKLEDEHLVFFCQMGKRGLQATQLARSLGYTGYG