TSTD2 Antibody

  • Contact Vendor

Target Tstd2
Species Cross Reactivity Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications WB, IHC
Target Species Homo sapiens
Target/Molecule Synonym C9orf97, chromosome 9 open reading frame 97, FLJ36724, PP4189, Rhodanese domain-containing protein 2, thiosulfate sulfurtransferase (rhodanese)-like domain containing 2, thiosulfate sulfurtransferase/rhodanese-like domain-containing protein 2
Unit 0.1 ml
Format Immunogen affinity purified
NCBI Gene Aliases C9orf97, FLJ36724
Company Novus Biologicals
Type Antibody
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:KPGIHLSPGEFHKEVEKFLSQANQEQSDTILLDCRNFYESKIGRFQGCLAPDIRKFSYFPSYVDKNLELFREKRVLMYCTGGIRCERGSAYLKAKGVC