RhoF Antibody

  • Contact Vendor

Target RHOF
Species Cross Reactivity Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications WB
Target Species Homo sapiens
Target/Molecule Synonym FLJ20247, ras homolog gene family, member F (in filopodia), Rho family GTPase Rif, rho-related GTP-binding protein RhoF, RIFARHF, Rho in filopodia
Unit 0.05 mg
Format Peptide affinity purified
Concentration LYOPH
NCBI Gene Aliases ARHF, FLJ20247, RIF
Company Novus Biologicals
Type Antibody
Immunogen Synthetic peptides corresponding to RHOF(ras homolog gene family, member F (in filopodia)) The peptide sequence was selected from the middle region of RHOF. Peptide sequence DNVLIKWFPEVTHFCRGIPMVLIGCKTDLRKDKEQLRKLRAAQLEPITYM