RhoG Antibody

  • Contact Vendor

Target Rhog
Species Cross Reactivity Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications WB, IHC
Target Species Homo sapiens
Target/Molecule Synonym ARHGMGC125835, MGC125836, ras homolog gene family, member G (rho G), rho-related GTP-binding protein RhoG, RhoG
Unit 0.1 ml
Format Immunogen affinity purified
NCBI Gene Aliases ARHG, MGC125835, MGC125836
Company Novus Biologicals
Type Antibody
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:KDLRAQPDTLRRLKEQGQAPITPQQGQALAKQIHAVRYL