RhoG Antibody

  • Contact Vendor

Target Rhog
Species Cross Reactivity Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications WB
Target Species Homo sapiens
Target/Molecule Synonym ARHGMGC125835, MGC125836, ras homolog gene family, member G (rho G), rho-related GTP-binding protein RhoG, RhoG
Unit 0.05 mg
Format Peptide affinity purified
Concentration LYOPH
NCBI Gene Aliases ARHG, MGC125835, MGC125836
Company Novus Biologicals
Type Antibody
Immunogen Synthetic peptide directed towards the C terminal of human RHOGThe immunogen for this antibody is RHOG. Peptide sequence LVGTKKDLRAQPDTLRRLKEQGQAPITPQQGQALAKQIHAVRYLECSALQ