FGD4 Antibody

  • Contact Vendor

Target FGD4
Species Cross Reactivity Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications ICC, IHC, IF
Target Species Homo sapiens
Target/Molecule Synonym Actin filament-binding protein frabin, CMT4HFLJ42663, DKFZp313E1818, FGD1 family, member 4, FYVE, RhoGEF and PH domain containing 4, FRABIN, frabin, FRABPDKFZp434K1572, MGC57222, RhoGEF and PH domain-containing protein 4, ZFYVE6FLJ34370
Unit 0.1 ml
Format Immunogen affinity purified
NCBI Gene Aliases CMT4H, DKFZp313E1818, DKFZp434K1572, FLJ34370, FLJ42663, FRABP, MGC57222, ZFYVE6
Company Novus Biologicals
Type Antibody
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:EPLLDTHIVNGERDETATAPASPTTDSCDGNASDSSYRTPGIGPVLPLEERGAETETKVQERENGESPLELEQLDQHHEMKETNEQ