FGD6 Antibody

  • Contact Vendor

Target Fgd6
Species Cross Reactivity Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications IHC
Target Species Homo sapiens
Target/Molecule Synonym FYVE, RhoGEF and PH domain containing 6, RhoGEF and PH domain-containing protein 6, zinc finger FYVE domain-containing protein 24
Unit 0.1 ml
Format Immunogen affinity purified
NCBI Gene Aliases ZFYVE24
Company Novus Biologicals
Type Antibody
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:ALKHYLLKPVQRIPQYRLLLTDYLKNLIEDAGDYRDTQDALAVVIEVANHANDTMKQGDNFQKLMQIQYSLNGHHEIVQPGRVFLKEGILMKLSRKVMQPRMFFLFNDALLYTTPVQSGMYKLNNMLSLAGMKVRKPTQEA