FGD5 Antibody

  • Contact Vendor

Target FGD5
Species Cross Reactivity Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications IHC
Target Species Homo sapiens
Target/Molecule Synonym FLJ00274, FLJ39957, FYVE, RhoGEF and PH domain containing 5, FYVE, RhoGEF and PH domain-containing protein 5, ZFYVE23Zinc finger FYVE domain-containing protein 23
Unit 0.1 ml
Format Immunogen affinity purified
NCBI Gene Aliases ZFYVE23
Company Novus Biologicals
Type Antibody
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:NSPQLKSRTGKLRASESPSSLIFYRDGKRKGVPFSRTVSRVESFEDRSRPPFLPLPLTKPRSISFPSADTSDYENIPAMNSDYENIQIPPRRPARAGAFTKLFEDQSRALSTANENDGYVD