PLEKHG1 Antibody

  • Contact Vendor

Target PLEKHG1
Species Cross Reactivity Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications IHC
Target Species Homo sapiens
Target/Molecule Synonym ARHGEF41, FLJ31738, KIAA1209, pleckstrin homology domain-containing family G member 1, pleckstrin homology domain containing, family G (with RhoGef domain) member 1
Unit 0.1 ml
Format Immunogen affinity purified
NCBI Gene Aliases ARHGEF41, FLJ31738, KIAA1209
Company Novus Biologicals
Type Antibody
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:SLKRAKRSTFLGLEADFVCCDSLRPFVSQDSLQLSEDEAPYHQATPDHGYLSLLYDSPSGNLSMPHKPVSDKLSEEVDEIWNDLENY