PLEKHG4B Antibody

  • Contact Vendor

Target PLEKHG4B
Species Cross Reactivity Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications IHC
Target Species Homo sapiens
Target/Molecule Synonym pleckstrin homology domain containing, family G (with RhoGef domain) member 4B
Unit 0.1 ml
Format Immunogen affinity purified
NCBI Gene Aliases FLJ43173, KIAA1909
Company Novus Biologicals
Type Antibody
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:YDRVDEEVHRLVLTSNNRLQQLEHLRELASLLEGNDQQSCQKGLQLAKENPQRTEEMVQDFRRGLSAVVSQAECREGELARWTRSSELCETVS