PLEKHG6 Antibody

  • Contact Vendor

Target PLEKHG6
Species Cross Reactivity Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications WB, IHC
Target Species Homo sapiens
Target/Molecule Synonym FLJ10665, pleckstrin homology domain-containing family G member 6, pleckstrin homology domain containing, family G (with RhoGef domain) member 6
Unit 0.1 ml
Format Immunogen affinity purified
NCBI Gene Aliases FLJ10665, MGC126315, MGC126353, MGC126354, MyoGEF
Company Novus Biologicals
Type Antibody
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:GLLMEVSAETLFGNVPSLIRTHRSFWDEVLGPTLEETRASGQPLDPIGLQSGFLTFGQRFHPYVQYCLRVKQTMAYAREQQETNPLFHAFVQWCE