RhoJ Antibody

  • Contact Vendor

Target Rhoj
Species Cross Reactivity Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications WB, IHC
Target Species Homo sapiens
Target/Molecule Synonym ARHJTC10B, FLJ14445, RASL7B, Ras-like protein family member 7B, RAS-like, family 7, member B, ras homolog gene family, member J, rho-related GTP-binding protein RhoJ, RHOI, TCLMGC34777, Tc10-like GTP-binding protein, TC10-like Rho GTPase
Unit 0.1 ml
Format Immunogen affinity purified
NCBI Gene Aliases ARHJ, FLJ14445, MGC34777, RASL7B, TC10B, TCL
Company Novus Biologicals
Type Antibody
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:CFSVVNPASYHNVQEEWVPELKDCMPHVPYVLIGTQIDLRDDPKTLARLLYMKEKPLTYEHGVKLAKAIGAQCYLECSALTQKGLKAVFDEAILTIFHPKKKKKRCSEG