RhoJ Antibody

  • Contact Vendor

Target Rhoj
Species Cross Reactivity Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications WB
Target Species Homo sapiens
Target/Molecule Synonym ARHJTC10B, FLJ14445, RASL7B, Ras-like protein family member 7B, RAS-like, family 7, member B, ras homolog gene family, member J, rho-related GTP-binding protein RhoJ, RHOI, TCLMGC34777, Tc10-like GTP-binding protein, TC10-like Rho GTPase
Unit 0.05 mg
Format Peptide affinity purified
Concentration LYOPH
NCBI Gene Aliases ARHJ, FLJ14445, MGC34777, RASL7B, TC10B, TCL
Company Novus Biologicals
Type Antibody
Immunogen Synthetic peptides corresponding to RHOJ (ras homolog gene family, member J) The peptide sequence was selected from the middle region of RHOJ. Peptide sequence LGLYDTAGQEDYNQLRPLSYPNTDVFLICFSVVNPASYHNVQEEWVPELK