RHBDF2 Antibody

  • Contact Vendor

Target Rhbdf2
Species Cross Reactivity Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications IHC
Target Species Homo sapiens
Target/Molecule Synonym FLJ22341, RHBDL5rhomboid family member 2, RHBDL6, Rhomboid 5 homolog 2, rhomboid 5 homolog 2 (Drosophila), rhomboid veinlet-like 5, Rhomboid veinlet-like protein 5, Rhomboid veinlet-like protein 6, rhomboid, veinlet-like 6, rhomboid, veinlet-like 6 (Drosophila), rhomboid-like protein 6
Unit 0.1 ml
Format Immunogen affinity purified
NCBI Gene Aliases FLJ22341, RHBDL5, RHBDL6
Company Novus Biologicals
Type Antibody
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:RKPPNLSITIPPPEKETQAPGEQDSMLPERKNPAYLKSVSLQEPRSRWQGSSEKRPGFRRQASLSQSIRKGAAQWFGVSGDWEGQRQQWQRRSLHHCSMRYGRLKASCQRDL