RHBDD1 Antibody

  • Contact Vendor

Target RHBDD1
Species Cross Reactivity Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications WB, IHC
Target Species Homo sapiens
Target/Molecule Synonym DKFZp547E052, EC 3.4.21, EC 3.4.21.-, MGC117258, rhomboid domain containing 1, rhomboid domain-containing protein 1
Unit 0.1 ml
Format Immunogen affinity purified
NCBI Gene Aliases DKFZp547E052, MGC117258
Company Novus Biologicals
Type Antibody
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:PLKKIMEACAGGFSSSVGYPGRQYYFNSSGSSGYQDYYPHGRPDHYEEAPRNYDTYTAGLSEEEQLERALQASLWDRGNTRNSPPPYGFHLSPEEMRRQRLHRFD