RHBDD2 Antibody

  • Contact Vendor

Target Rhbdd2
Species Cross Reactivity Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications IHC
Target Species Homo sapiens
Target/Molecule Synonym H_RG122E10.2a, H_RG122E10.2b, rhomboid domain containing 2, rhomboid domain-containing protein 2, rhomboid, veinlet-like 7, veinlet-like 7 (Drosophila)
Unit 0.1 ml
Format Immunogen affinity purified
NCBI Gene Aliases NPD007, RHBDL7
Company Novus Biologicals
Type Antibody
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:HMPTLPPYQPASGLCYVQNHFGPNPTSSSVYPASAGTSLGIQPPTPVNSPGTVYSGALGTPGAAGSKESSRVP