RHBDD3 Antibody

  • Contact Vendor

Target RHBDD3
Species Cross Reactivity Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications IHC
Target Species Homo sapiens
Target/Molecule Synonym C22orf3, chromosome 22 open reading frame 3, HS984G1A, pituitary tumor apoptosis, PTAG, rhomboid domain containing 3, rhomboid domain-containing protein 3
Unit 0.1 ml
Format Immunogen affinity purified
NCBI Gene Aliases C22orf3, HS984G1A, PTAG
Company Novus Biologicals
Type Antibody
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:HWEDSALPPPSLRPVQPTWEGSSEAGLDWAGASFSPGTPMWAALDEQMLQEGIQASLLDGPAQEPQSAPWLSKSSVSSL