RHBDL2 Antibody

  • Contact Vendor

Target RHBDL2
Species Cross Reactivity Canis lupus familiaris, Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications WB
Target Species Homo sapiens
Target/Molecule Synonym EC 3.4.21.105, FLJ20435, MGC16997, rhomboid (veinlet, Drosophila)-like 2, rhomboid protease 2, rhomboid, veinlet-like 2 (Drosophila), Rhomboid-like protein 2, rhomboid-related protein 2, RRP2
Unit 0.05 mg
Format Affinity purified
Concentration LYOPH
NCBI Gene Aliases MGC16997, RRP2
Company Novus Biologicals
Type Antibody
Immunogen Synthetic peptides corresponding to RHBDL2(rhomboid, veinlet-like 2 (Drosophila)) The peptide sequence was selected from the N terminal of RHBDL2 (NP_060291). Peptide sequence KWMLPEKSRGTYLERANCFPPPVFIISISLAELAVFIYYAVWKPQKQWIT