Ropporin 1-like Antibody

  • Contact Vendor

Target ropn1l
Species Cross Reactivity Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications WB, IHC
Target Species Homo sapiens
Target/Molecule Synonym AKAP-associated sperm protein, ASPFLJ23003, FLJ25776, radial spoke head 11 homolog, rhophilin associated tail protein 1-like, ROPN1-like protein, ropporin 1-like, ropporin-1-like protein, RSPH11
Unit 0.1 ml
Format Immunogen affinity purified
NCBI Gene Aliases ASP, FLJ23003, FLJ25776, RSPH11
Company Novus Biologicals
Type Antibody
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:IPFKTFSYVYRYLARLDSDVSPLETESYLASLKENIDARKNGMIGLSDFFFPKRKLLESIENSEDV