Rhot1 Antibody

  • Contact Vendor

Target RHOT1
Species Cross Reactivity Canis lupus familiaris, Sus scrofa, Rattus norvegicus, Drosophila melanogaster, Mus musculus, Danio rerio, Bos taurus, Gallus gallus, Homo sapiens, Xenopus laevis
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications WB, IHC
Target Species Homo sapiens
Target/Molecule Synonym ARHT1, EC 3.6.5, EC 3.6.5.-, FLJ11040, FLJ12633, hMiro-1, mitochondrial Rho 1, MIRO-1mitochondrial Rho GTPase 1, rac-GTP binding protein-like protein, Rac-GTP-binding protein-like protein, Ras homolog gene family member T1, ras homolog gene family, member T1
Unit 0.05 mg
Format Affinity purified
Concentration LYOPH
NCBI Gene Aliases ARHT1, FLJ11040, FLJ12633, MIRO-1
Company Novus Biologicals
Type Antibody
Immunogen Synthetic peptides corresponding to RHOT1(ras homolog gene family, member T1) The peptide sequence was selected from the N terminal of RHOT1 (NP_060777). Peptide sequence MKKDVRILLVGEPRVGKTSLIMSLVSEEFPEEVPPRAEEITIPADVTPER