Rhot1 Antibody

  • Contact Vendor

Target RHOT1
Species Cross Reactivity Rattus norvegicus, Mus musculus, Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications WB
Target Species Homo sapiens
Target/Molecule Synonym ARHT1, EC 3.6.5, EC 3.6.5.-, FLJ11040, FLJ12633, hMiro-1, mitochondrial Rho 1, MIRO-1mitochondrial Rho GTPase 1, rac-GTP binding protein-like protein, Rac-GTP-binding protein-like protein, Ras homolog gene family member T1, ras homolog gene family, member T1
Unit 0.05 mg
Format Peptide affinity purified
Concentration LYOPH
NCBI Gene Aliases ARHT1, FLJ11040, FLJ12633, MIRO-1
Company Novus Biologicals
Type Antibody
Immunogen Synthetic peptides corresponding to RHOT1(ras homolog gene family, member T1) The peptide sequence was selected from the middle region of RHOT1. Peptide sequence ASAVTVTRDKKIDLQKKQTQRNVFRCNVIGVKNCGKSGVLQALLGRNLMR