RHOT2 Antibody

  • Contact Vendor

Target RHOT2
Species Cross Reactivity Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications IHC
Target Species Homo sapiens
Target/Molecule Synonym ARHT2, C16orf39, chromosome 16 open reading frame 39, EC 3.6.5, EC 3.6.5.-, hMiro-2, mitochondrial Rho GTPase 2, MIRO-2mitochondrial Rho 2, RASL, Ras homolog gene family member T2, ras homolog gene family, member T2
Unit 0.1 ml
Format Immunogen affinity purified
NCBI Gene Aliases ARHT2, C16orf39, MIRO-2, RASL
Company Novus Biologicals
Type Antibody
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:ACLMFDGSDPKSFAHCASVYKHHYMDGQTPCLFVSSKADLPEGVAVSGPSPAEFCRKHRLPAPVPFSCAGPAEPSTTIFTQLATMAAFPHLVHAELHPSSF