RTKN2 Antibody

  • Contact Vendor

Target RTKN2
Species Cross Reactivity Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications WB, IHC
Target Species Homo sapiens
Target/Molecule Synonym bA531F24.1, DKFZp686J10120, Em:AC024597.2, FLJ39352, PH domain-containing family K member 1, pleckstrin homology domain containing, family K member 1, Pleckstrin homology domain-containing family K member 1, PLEKHK1, rhotekin 2, rhotekin-2
Unit 0.1 ml
Format Immunogen affinity purified
NCBI Gene Aliases DKFZp686J10120, PLEKHK1, bA531F24.1
Company Novus Biologicals
Type Antibody
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:AQPACMAEDAFAGFLNQQQMVEGLISWRRLYCVLRGGKLYCFYSPEEIEAKVEPALVVPINKETRIRAMDKDAKKRIHNFSVINPVP