WRCH1 Antibody

  • Contact Vendor

Target RHOU
Species Cross Reactivity Rattus norvegicus, Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications WB
Target Species Homo sapiens
Target/Molecule Synonym ARHU, CDC42L1GTP-binding protein-like 1, DJ646B12.2, fJ646B12.2, FLJ10616,2310026M05Rik, G28K, GTP-binding protein like 1, GTP-binding protein SB128, hG28K, ras-like gene family member U, ras homolog gene family, member U, rho-related GTP-binding protein RhoU, Rho GTPase-like protein ARHU, Ryu GTPase, Wnt-1 responsive Cdc42 homolog 1, WRCH-1, WRCH1CDC42-like GTPase 1
Unit 0.05 mg
Format Peptide affinity purified
Concentration LYOPH
NCBI Gene Aliases ARHU, CDC42L1, DJ646B12.2, FLJ10616, WRCH1, fJ646B12.2, hG28K
Company Novus Biologicals
Type Antibody
Immunogen Synthetic peptides corresponding to RHOU(ras homolog gene family, member U) The peptide sequence was selected from the C terminal of RHOU. Peptide sequence LKEVFDAAIVAGIQYSDTQQQPKKSKSRTPDKMKNLSKSWWKKYCCFV